Protein Info for Pf6N2E2_5049 in Pseudomonas fluorescens FW300-N2E2

Annotation: acetyltransferase, GNAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF13302: Acetyltransf_3" amino acids 11 to 152 (142 residues), 126.6 bits, see alignment E=1.2e-40 PF00583: Acetyltransf_1" amino acids 57 to 150 (94 residues), 33.8 bits, see alignment E=3.6e-12

Best Hits

Swiss-Prot: 56% identical to ATSE3_PSEAE: Acetyltransferase PA3944 (PA3944) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4918)

Predicted SEED Role

"acetyltransferase, GNAT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZN17 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Pf6N2E2_5049 acetyltransferase, GNAT family (Pseudomonas fluorescens FW300-N2E2)
MEPILELESARLLLRQWRDDDLPEFAAMCADPQVMRYFPARLSRLESAALIGRVRGHFAE
HGFGLWALERKDTGAFIGFTGLGVVGFDAPFTPAIEIGWRLAREHWGLGYASEAAWTALR
CAFDQLKLDEVVAFTAVDNLPSQKVMQAIGMQHDPADDFEHPTLAVGHPLRHHVLYRINR
EQWLQTLHG