Protein Info for Pf6N2E2_5047 in Pseudomonas fluorescens FW300-N2E2

Annotation: NAD(FAD)-utilizing dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 PF03486: HI0933_like" amino acids 26 to 417 (392 residues), 384.7 bits, see alignment E=1.4e-118 PF01494: FAD_binding_3" amino acids 26 to 51 (26 residues), 26.8 bits, see alignment (E = 9.5e-10) TIGR00275: flavoprotein, HI0933 family" amino acids 27 to 417 (391 residues), 288.2 bits, see alignment E=9.5e-90 PF13450: NAD_binding_8" amino acids 29 to 60 (32 residues), 23 bits, see alignment (E = 2.4e-08) TIGR03862: flavoprotein, TIGR03862 family" amino acids 47 to 424 (378 residues), 543 bits, see alignment E=3.2e-167

Best Hits

KEGG orthology group: K07007, (no description) (inferred from 93% identity to pba:PSEBR_a4920)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A422 at UniProt or InterPro

Protein Sequence (430 amino acids)

>Pf6N2E2_5047 NAD(FAD)-utilizing dehydrogenases (Pseudomonas fluorescens FW300-N2E2)
VLIECAAYSTAPQFAMTQAAKPSTPNVTIIGGGPAGLMAAEVLSQAGIQVDLYDGMPSVG
RKFLLAGVGGMNITHSEAFPAFLSRYAERAPNLAPLLRAFGADELCTWIHGLGIDTFVGS
SGRVFPTDMKAAPLLRAWLKRLRDAGVTIHTRHRWLGWHPDGSLRIAAPEGEKTLQPDAT
LLALGGGSWSRLGSDGAWMLPLEQRGVVLAPLQPSNCGFEVQAWSDLMVSKFAGAPLKNI
AIGLNDDVPRLGECVITATGIEGSLIYALSAAIREAINQHGSATIHLDLLPGRPVDKIQQ
ALSKPRGSRSMAKHLHSQLGIDGVKAALLRELTPADCFAEPARLAQAIKALPLSLVKTRP
LDEAISSAGGVTFEALDERLMLKQIPGVFCAGEMLDWEAPTGGYLLTACFASGRAAGLGM
KEFLRNSGKL