Protein Info for Pf6N2E2_5045 in Pseudomonas fluorescens FW300-N2E2

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details PF00892: EamA" amino acids 13 to 142 (130 residues), 64.3 bits, see alignment E=7.6e-22 amino acids 152 to 286 (135 residues), 64.4 bits, see alignment E=7e-22

Best Hits

Swiss-Prot: 55% identical to YEDA_ECOLI: Uncharacterized inner membrane transporter YedA (yedA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4922)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A317 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Pf6N2E2_5045 Permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas fluorescens FW300-N2E2)
MPGPRRFPLPLIAAFFALYVIWGSTYLVIRIGVEHWPPLLLAGIRFVLAGSLMYGFLRWR
GAPAPTWAQWKAGAIIGVLLLSFGNGAVSVAEHTGVASGVAALAVATVPLFTLLCGYFWG
ARNTRLEWAGIVLGLIGIAMLNLGSNLQSSPLGATLLVFAAASWAFGSVLSKHLPLPAGA
MASAVEMLIGGVVLLIGSVASGEHLDSMPPLEGWFALAYLTCFGSIVAFNAYMYLLKHVR
PAAATSYAYVNPAVAVLLGIVFAGETIGAEESVAMLVIISAVVLIGLPQWRKPKPAPAAS