Protein Info for Pf6N2E2_5014 in Pseudomonas fluorescens FW300-N2E2

Annotation: Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 transmembrane" amino acids 15 to 45 (31 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 83 to 109 (27 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 481 to 500 (20 residues), see Phobius details PF20154: LNT_N" amino acids 18 to 181 (164 residues), 128 bits, see alignment E=3.8e-41 TIGR00546: apolipoprotein N-acyltransferase" amino acids 61 to 453 (393 residues), 305.6 bits, see alignment E=3e-95 PF00795: CN_hydrolase" amino acids 229 to 469 (241 residues), 96.9 bits, see alignment E=1.3e-31

Best Hits

Swiss-Prot: 82% identical to LNT_PSESM: Apolipoprotein N-acyltransferase (lnt) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03820, apolipoprotein N-acyltransferase [EC: 2.3.1.-] (inferred from 98% identity to pba:PSEBR_a4948)

Predicted SEED Role

"Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE" in subsystem Phosphate metabolism or Copper homeostasis: copper tolerance (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A403 at UniProt or InterPro

Protein Sequence (507 amino acids)

>Pf6N2E2_5014 Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE (Pseudomonas fluorescens FW300-N2E2)
MRWITRPGWPGNLLAMAAGAITTLALAPFDFWPLALLAVGLFYAGLRELSPRQALGRGWC
FGFGLFGAGTSWIYVSIHNFGGASVLLAGLLMLLFIAAIAWFFALPAWLWARWLRRNEAP
LADALAFAALWLGQEAFRGWFLTGFPWLYSGYSQLNGPLAGLAPLGGMWLISFTLALTAA
LLYNAPRLIRTGRKGFIAAGVMLLIGPWVAGLALKGHAWTSPSGDPLSVAAIQGNIEQSM
KWDPEQLNAQLALYRDMSFASKRVDLLIWPETAVPVLKESAQGYLDMMGSFAAERHSALI
TGVPIRQLVRHEKRYFNGITVTGEGDGTYLKQKLVPFGEYVPLQDILRGLIAFFDLPMSD
FARGPADQPLLQAKGYQIAPFICYEVVYPEFAASLSARSDLLLTISNDTWFGTSIGPLQH
LQMAQMRALEAGRWMIRATNNGVTGLINPFGQITAQIPQFERGILYGEVVPMHDLTPYLQ
WRSWPLIILCLSLLGWALMASRMAKTV