Protein Info for Pf6N2E2_5000 in Pseudomonas fluorescens FW300-N2E2

Annotation: Rare lipoprotein A precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF03330: DPBB_1" amino acids 105 to 194 (90 residues), 90.9 bits, see alignment E=5.1e-30 TIGR00413: rare lipoprotein A" amino acids 107 to 199 (93 residues), 146.3 bits, see alignment E=6.1e-47 PF05036: SPOR" amino acids 267 to 334 (68 residues), 45.5 bits, see alignment E=8e-16

Best Hits

Swiss-Prot: 70% identical to RLPA_PSEAB: Endolytic peptidoglycan transglycosylase RlpA (rlpA) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K03642, rare lipoprotein A (inferred from 98% identity to pba:PSEBR_a4961)

Predicted SEED Role

"Rare lipoprotein A precursor" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A4V9 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Pf6N2E2_5000 Rare lipoprotein A precursor (Pseudomonas fluorescens FW300-N2E2)
MRALPTYLPLKAKPLKLVALAALSLLVVSCSTSRAPAQKNSTAVRATPGLDINRAHKDGA
PWWDVDVSRIPDATPTLHTGPYKANPYTVLGKTYFPLSDSKRYVASGTASWYGTKFHGQN
TANGEVYDLYGMSAAHKTLPLPSYVRVTNLDNNKSVILRVNDRGPFYSDRIIDLSYAAAK
KLGYAEIGTARVKVEGIDPQEWWAQRGRPAPLMLNEPKVAQNAAPTVTASTGTVEQWTPP
PQQHAAAVVPVQLDAKKNASATASGQFLQVGAFANPDAAELLRSKLSSMVSAPVFISSIV
RNQQTLHRVRLGPIGSPGEVQQVQNSVRLANLGSPSLVTAE