Protein Info for Pf6N2E2_4999 in Pseudomonas fluorescens FW300-N2E2

Annotation: Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13406: SLT_2
  • amino acids 36 to 327 (292 residues), 356.3 bits, E=1.3e-110
• TIGR02282: lytic murein transglycosylase B
  • amino acids 40 to 329 (290 residues), 403.3 bits, E=2.7e-125

Best Hits

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 100% identity to pba:PSEBR_a4962)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

See A0A165ZMW5 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Pf6N2E2_4999 Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-) (Pseudomonas fluorescens FW300-N2E2)
MQAMRGWSTRYAPWIGLVGFLGGAPHAQAGEYEGSPQVAEFVGEMTRDYGFAGEQLMGVF
REAERKQSILDAISRPAERVKQWSEYRPMFITEARIARGVDFWRQHEAALARAEQEYGVP
AQFIVAIIGVETFFGRNTGNFRVIDALSTLGFDYPPRAEFFRKELREFLLLAREEQVDPL
TLKGSYAGAMGLPQFMPSSFRAYAVDFDDDGHINIWTNPTDAIGSVASYFKRHGWEAGQP
VVSRADVRGEQVDEGLTEGIEPTKTVGELRALGWSSHDALRDDMPVTAIRLEGEQGPEYW
MGLKNFYAITRYNRSVMYAMAVYQLSEELVKARGVK