Protein Info for Pf6N2E2_499 in Pseudomonas fluorescens FW300-N2E2

Annotation: Possible pyrimidine permease in reductive pathway

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 transmembrane" amino acids 47 to 71 (25 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 124 to 149 (26 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 311 to 334 (24 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 392 to 412 (21 residues), see Phobius details amino acids 433 to 452 (20 residues), see Phobius details amino acids 458 to 479 (22 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 36 to 470 (435 residues), 300.3 bits, see alignment E=1.2e-93

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a3366)

Predicted SEED Role

"Possible pyrimidine permease in reductive pathway" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YUM6 at UniProt or InterPro

Protein Sequence (492 amino acids)

>Pf6N2E2_499 Possible pyrimidine permease in reductive pathway (Pseudomonas fluorescens FW300-N2E2)
MTRSTVTERDGLFELEAGSDVLDSPRYNHDIAPTKVHERTWNKWHITALWVGMAICVPTY
TLGGVLTAYFGLTVGEALLAILFANIIVLIPLTLNAFAGTKYGIPFPVLLRSSFGVIGSN
VPCLIRALVACGWFGIQTMFGGLAIHLFLGSVFEGWKSLGGTGEVIGFMVFWVINLWVVL
RGAESIKWLETLSAPLLVLVGVGLLVWALPNVSLTELMAVPAKRPEGAGVTSYFLAGLTA
MVGFWATLSLNIPDFSRYARSQKDQIVGQIIGLPLTMFLFASLGVVMTAASEKLVGVTVS
DPVTLIGHIQSPVWVALAMVLIIVATLSTNTAANIVSPTNDFQNLAPKLIGRTKAVMLTG
LVGLALMAHELLKKLGLIVSEVSLESVYSNWLLGYSSLLGPIAGIMVVDYFLIKKQQLDL
AGLYRDDVYPAWNWNGFIAFGVPVVLTLLSLGSDAFSWFYSYGWFTGSALGGVIYYGLCS
LRASPSIAKSAV