Protein Info for Pf6N2E2_4988 in Pseudomonas fluorescens FW300-N2E2

Annotation: Antiholin-like protein LrgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 43 (18 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details PF03788: LrgA" amino acids 13 to 106 (94 residues), 68.3 bits, see alignment E=2.4e-23

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4973)

Predicted SEED Role

"Antiholin-like protein LrgA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H920 at UniProt or InterPro

Protein Sequence (121 amino acids)

>Pf6N2E2_4988 Antiholin-like protein LrgA (Pseudomonas fluorescens FW300-N2E2)
MLLRGLTWLVLFQLLGTAINHLFLPVLPGPIIGLLLLLGYLVMRGEVSEPLNLAAGSLLR
YLPLLLVPPAVGVMVYARAIAADFWAIVGALTLSLVLSVALTGVLMQRLARRHIAAPEDS
Q