Protein Info for Pf6N2E2_4987 in Pseudomonas fluorescens FW300-N2E2

Annotation: MaoC-like domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF13452: FAS1_DH_region" amino acids 13 to 123 (111 residues), 25 bits, see alignment E=1.9e-09 PF01575: MaoC_dehydratas" amino acids 13 to 119 (107 residues), 94.8 bits, see alignment E=3.1e-31

Best Hits

Swiss-Prot: 49% identical to ECH1_MYCTU: Probable enoyl-CoA hydratase 1 (Rv0130) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4974)

MetaCyc: 43% identical to 4-chloro-3-hydroxybutyryl-CoA dehydratase (Salinispora tropica)
4.2.1.-

Predicted SEED Role

"MaoC-like domain protein"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0Z7 at UniProt or InterPro

Protein Sequence (151 amino acids)

>Pf6N2E2_4987 MaoC-like domain protein (Pseudomonas fluorescens FW300-N2E2)
MPYVPVAALKDYVGKELGRSEWLTIDQDRINLFAEATGDFQFIHVDPVKAAQTPFGSTIA
HGFLSLSLMPKLMEDILILPEGVKMVVNYGLDSVRFIQPVKVDSKVRLKVDLVEVTEKKP
GQWLLKATATLEIEGSEKPAYIAEPLSLCFV