Protein Info for Pf6N2E2_4986 in Pseudomonas fluorescens FW300-N2E2

Annotation: MORN repeat family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02493: MORN" amino acids 35 to 56 (22 residues), 15 bits, see alignment (E = 1.9e-06) amino acids 58 to 79 (22 residues), 8.5 bits, see alignment (E = 0.00023) amino acids 81 to 100 (20 residues), 17.2 bits, see alignment (E = 3.7e-07) amino acids 103 to 118 (16 residues), 10.5 bits, see alignment (E = 5.1e-05) amino acids 125 to 146 (22 residues), 12.1 bits, see alignment (E = 1.6e-05) amino acids 148 to 169 (22 residues), 9.5 bits, see alignment (E = 0.00011) amino acids 171 to 192 (22 residues), 13.7 bits, see alignment (E = 4.9e-06) amino acids 194 to 216 (23 residues), 19.2 bits, see alignment (E = 8.8e-08) amino acids 218 to 238 (21 residues), 14.2 bits, see alignment (E = 3.4e-06) amino acids 263 to 285 (23 residues), 11.7 bits, see alignment (E = 2.2e-05) PF01650: Peptidase_C13" amino acids 400 to 541 (142 residues), 118.7 bits, see alignment E=3.3e-38

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4975)

Predicted SEED Role

"MORN repeat family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A108 at UniProt or InterPro

Protein Sequence (572 amino acids)

>Pf6N2E2_4986 MORN repeat family protein (Pseudomonas fluorescens FW300-N2E2)
MRLLVPLTLILLLTACGNGESPLPPDARLPDGGRYRGDLVDGLLQGQGRIDYPNGSWYTG
QFDKGQWHGTGEWHGSNGEVYRGQFQQGLFHGQGSLTTPTSSYTGGFKLGRRDGEGTLKE
NGMTYRGEFKADRYSGLGRLELDDGSQYQGPFANGKPNGEGQRFDASGNQFTGHFVDGQL
QGKGTFNSAEGDVYIGGFKNNQLNGRGRYENADGDVWIGQFKDGALTGKGELIGADGSHY
LGQFNDWRFTGEGRLNLPDGSFYVGQFESDSYHGRGTLALTDGTVQSGTWANGQRVRDAD
GRLLPDVLELGLLAQGRLLDDALANIPASTPAVELYSLTLGGDGKQSVFLRESDYVANML
ASRFGAFGQIRLVNHRDHLGDRPMASRESLRRAAATLAERSGPEDLIFLYLTSHGTSEHE
LVLDQPRMELADLPADELAVVLAPLKNRDKIVVISACYSGGFIPALKDERTLIMTASRAD
RVSFGCSEEANFTYFGDALFAQALNQTDDLEQAFKRAKATVAEREQADNFEASEPQMWAP
RTVLSHWQLLRKQQARKALQSAALNDEATKSN