Protein Info for Pf6N2E2_4976 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ethanolamine ammonia-lyase light chain (EC 4.3.1.7)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF05985: EutC" amino acids 10 to 247 (238 residues), 322.4 bits, see alignment E=7.4e-101

Best Hits

Swiss-Prot: 85% identical to EUTC_PSEF5: Ethanolamine ammonia-lyase light chain (eutC) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03736, ethanolamine ammonia-lyase small subunit [EC: 4.3.1.7] (inferred from 96% identity to pba:PSEBR_a4985)

Predicted SEED Role

"Ethanolamine ammonia-lyase light chain (EC 4.3.1.7)" in subsystem Ethanolamine utilization (EC 4.3.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.7

Use Curated BLAST to search for 4.3.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0Y9 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Pf6N2E2_4976 Ethanolamine ammonia-lyase light chain (EC 4.3.1.7) (Pseudomonas fluorescens FW300-N2E2)
MEKKPVDPQNPWLNLRNLTPARIALGRTGTSLPTQAQLDFQYAHAQARDAVHLAFDHQGI
RAQLSERGRESLLLHSAAADRHSYLQRPDLGRRLDDVSAQVLDDYAKAHPGGVDLAIVVA
DGLSALAVHRHTLPFLARLEEQIVADGWSVSPVILVEQGRVAVADEVAERLGAKMSVILI
GERPGLSSPDSLGLYFTYAPKVGLTDAYRNCISNVRLEGLSYGMAAHRLIYLMREACRRQ
LSGVNLKDEAQVHTLESENTADMKGNFLLMPPRN