Protein Info for Pf6N2E2_4974 in Pseudomonas fluorescens FW300-N2E2

Annotation: DedA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 53 to 80 (28 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details PF09335: SNARE_assoc" amino acids 48 to 172 (125 residues), 73.6 bits, see alignment E=1e-24

Best Hits

Swiss-Prot: 43% identical to Y364_MYCTU: Uncharacterized membrane protein Rv0364 (Rv0364) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03975, membrane-associated protein (inferred from 99% identity to pba:PSEBR_a4987)

Predicted SEED Role

"DedA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2Q2 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Pf6N2E2_4974 DedA protein (Pseudomonas fluorescens FW300-N2E2)
MDFNPLDLILHLDVYLDMLVTNYGTWVYAILFLVIFCETGLVVTPFLPGDSLLFIAGAVA
AGGAMDPLLLGGLLMLAAILGDSTNYLIGRTAGEKLFSNPNSKIFRRDYLQQTHDFYDKH
GGKTVTLARFLPIIRTFAPFVAGVGKMNYLRFFGFSVLGTVLWVGGLVTLGYFFGNVPFI
KQNLSLLVVGIILVSLLPMIISLVRSKLSQRASKA