Protein Info for Pf6N2E2_4956 in Pseudomonas fluorescens FW300-N2E2

Annotation: Rhs family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1242 transmembrane" amino acids 269 to 293 (25 residues), see Phobius details amino acids 308 to 328 (21 residues), see Phobius details PF20148: DUF6531" amino acids 446 to 519 (74 residues), 72.6 bits, see alignment 4.1e-24 PF25023: TEN_YD-shell" amino acids 571 to 790 (220 residues), 37 bits, see alignment E=1.7e-13 amino acids 761 to 887 (127 residues), 27.1 bits, see alignment E=1.7e-10 amino acids 909 to 1051 (143 residues), 41.6 bits, see alignment E=7.1e-15 TIGR01643: YD repeat (two copies)" amino acids 636 to 677 (42 residues), 18 bits, see alignment (E = 1.6e-07) amino acids 723 to 763 (41 residues), 20.9 bits, see alignment (E = 1.9e-08) amino acids 744 to 772 (29 residues), 24.5 bits, see alignment (E = 1.4e-09) amino acids 806 to 846 (41 residues), 30.4 bits, see alignment (E = 1.9e-11) amino acids 847 to 887 (41 residues), 27.2 bits, see alignment (E = 2e-10) amino acids 889 to 930 (42 residues), 34.9 bits, see alignment (E = 7.1e-13) amino acids 1042 to 1079 (38 residues), 27.1 bits, see alignment (E = 2.1e-10) PF05593: RHS_repeat" amino acids 744 to 774 (31 residues), 31.9 bits, see alignment (E = 2e-11) amino acids 806 to 841 (36 residues), 30.4 bits, see alignment (E = 6.2e-11) amino acids 847 to 882 (36 residues), 30.9 bits, see alignment (E = 4.4e-11) amino acids 868 to 905 (38 residues), 37.1 bits, see alignment (E = 4.8e-13) amino acids 889 to 925 (37 residues), 35.2 bits, see alignment (E = 1.9e-12) amino acids 910 to 947 (38 residues), 24.9 bits, see alignment (E = 3.3e-09) amino acids 1022 to 1054 (33 residues), 32.4 bits, see alignment (E = 1.4e-11)

Best Hits

Predicted SEED Role

"Rhs family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1242 amino acids)

>Pf6N2E2_4956 Rhs family protein (Pseudomonas fluorescens FW300-N2E2)
MFAPDKLLALNNTIGSLVVAAMDPDQPDVEAVLADFRACLNDYDAWAESFWAGWALDLEQ
VFKVGNEVSLAAPKNLDQPISATVVACPAGGPLTLVHMFQAARFVPIGDTPVMLEPVTGG
EPGKETFGEPVHHVIGPSGVLEIPECWRGGRYRITFFPHVTADHVKALYASYQGVMDELE
GWLKAEWDEFQPLWAAFSEAGFRERYDLVQQADWRGFENALHQLWDDVKQVFQLLADLQA
NSEKLLEYLTQVELEQLLSASSEAIAKGLMVLSDEPLLFVHMVAFVSWLRMLPPQYMAEV
VGEMRTSVLINFLLMRLTGALGMGVRMSGKVLGQLRSARAREWLTASSLRLAQRSTDRLD
RHPDVLKPLVVSAQRAPLKPTPVGPLHITPEHSPPLAISNPAAVAREKSHGSTRLSKHEP
HDDAPAQSKNPNGDSADTAAQTQTSGCPVSMVTGEELLTLDDGTLDGRLPFVFTRLYRTS
AADLDVGLGRGWSHALAHRLELKGEQVTWVDQENRRTTFPLPNAQRPAIHNSLARAAIYL
GAEPDELIVAQPGENAPFLHFRDGHLTALSDRYDNRLTLQRNIHGDISRLDNGAGRALRL
RYEQRHLIAVDYQSFHPAITLDEAWRTEQTLMSYRYDGRFRLIEATNAAGESERYDYDDQ
HVILQRQLAGGASFYWEWQGAGRAARCVRHWASFAQMDSRYTWGEHGSVTVQHLDGSQEV
YVHDDRARLVRKVEPDGGEHLKAYDEQGRLIAEQDPLGAVTEYRYDDVGRLLALIPPVDA
PTSYEYRNGFLHTRARGQAVWRYRRNARGDVIVLIDPAGRRTEYAYDAHGQLLARYDPDG
GEHRFTWSRLGQLTEEILPDGSRRRFSYDALGRLLSRQDEHGALTHYQWDAVGRLLQVTL
PNGATRTWRYNAYGKITAERDEQGRLTRYEYADDLHLVSRRLNPDGSELKYRYDSARLLL
TEIENESGEKYQLDYTPNGLIRQQVGFDGQRTTYAYDLNGHLLEKTEHGEDGSQRLTQYQ
RDAAGRLRVKTLPDGQAIEYRYDELGRLVHVNDGSDHPLAFEYDAQDRLVCEHQGWGTLR
YHYDACGRLNHLRLPDDSQLDYHHAPGGALTAIDLNGSRLTEHRFVGGRERQRQQGRLLS
DYDYDEQGRLKAQTVWQSQQQQLFWRDYAYSAKGNLQTLSDNRSRRSYQYDPLDRLTRID
FSHSDPPEHFCHDPAGNLMMQDRPGPDHPQGQPPAERGRPPL