Protein Info for Pf6N2E2_4923 in Pseudomonas fluorescens FW300-N2E2

Annotation: Transcription termination protein NusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 TIGR01951: transcription antitermination factor NusB" amino acids 27 to 154 (128 residues), 142.4 bits, see alignment E=4.9e-46 PF01029: NusB" amino acids 29 to 153 (125 residues), 110.9 bits, see alignment E=3.1e-36

Best Hits

Swiss-Prot: 97% identical to NUSB_PSEPF: Transcription antitermination protein NusB (nusB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03625, N utilization substance protein B (inferred from 99% identity to pba:PSEBR_a5037)

Predicted SEED Role

"Transcription termination protein NusB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0W3 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Pf6N2E2_4923 Transcription termination protein NusB (Pseudomonas fluorescens FW300-N2E2)
VISDESDRFNPRDPKPADAGKPSKSAKRREARQLATQALYQWHMAKQSLNEIEAQFRVDN
DFSDVDGAYFREILHGVPQFKTEIDTALTPCLDLTIEELDPVELAVLRLSTWELLKRVDV
PYRVVINEGIELAKVFGSTDGHKFVNGVLDKLAPRLREAEVKAFKR