Protein Info for Pf6N2E2_4918 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ribonucleotide reductase transcriptional regulator NrdR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 TIGR00244: transcriptional regulator NrdR" amino acids 35 to 181 (147 residues), 233.1 bits, see alignment E=6e-74 PF22811: Zn_ribbon_NrdR" amino acids 35 to 76 (42 residues), 78.8 bits, see alignment 2.2e-26 PF03477: ATP-cone" amino acids 86 to 170 (85 residues), 67.3 bits, see alignment E=1.5e-22

Best Hits

Swiss-Prot: 99% identical to NRDR_PSEPF: Transcriptional repressor NrdR (nrdR) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K07738, transcriptional repressor NrdR (inferred from 97% identity to pst:PSPTO_0689)

Predicted SEED Role

"Ribonucleotide reductase transcriptional regulator NrdR" in subsystem Ribonucleotide reduction

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0D0PM63 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Pf6N2E2_4918 Ribonucleotide reductase transcriptional regulator NrdR (Pseudomonas fluorescens FW300-N2E2)
MDLTVSPSVYRKPYGLSCQWDALPWPSLFLLPATMHCPFCGANDTKVIDSRLVAEGEQVR
RRRECLACGERFTTFETAELVLPRLIKTDGSRQPFDEEKLRAGMQRALEKRPVSVERLEA
ALVHIKHKLRATGEREVKSLVVGELVMAELQKLDEVAYIRFASVYRRFQDLNEFREEIDR
LAREPVKE