Protein Info for Pf6N2E2_4912 in Pseudomonas fluorescens FW300-N2E2

Annotation: Methionine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00005: ABC_tran" amino acids 27 to 180 (154 residues), 108.6 bits, see alignment E=4e-35

Best Hits

Swiss-Prot: 38% identical to LOLD_HYDCU: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Hydrogenovibrio crunogenus (strain XCL-2)

KEGG orthology group: K02003, (no description) (inferred from 98% identity to pba:PSEBR_a5047)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2K4 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Pf6N2E2_4912 Methionine ABC transporter ATP-binding protein (Pseudomonas fluorescens FW300-N2E2)
MTQALIELSDLGFSWPGHPPLLDIPAFRLEAGETLFLKGPSGSGKTTLLGLLGGVQTPDR
GSIRLLGQELSELGAGRRDRFRVDHTGYIFQQFNLLPFLSVRENVELPCHFSKLRAQRAI
QRHGSVDQAAATLLAHLGLTDPNLLGRRADSLSIGQQQRVAAARALIGQPELVIADEPTS
ALDYDARENFLRLLFAECREAGSSLLFVSHDQSLAPLFDRNLSLADLNRAATPLEV