Protein Info for Pf6N2E2_490 in Pseudomonas fluorescens FW300-N2E2

Annotation: PhaK-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details PF03573: OprD" amino acids 44 to 431 (388 residues), 529.6 bits, see alignment E=2.8e-163

Best Hits

Swiss-Prot: 71% identical to GALP_PSEPK: Porin-like protein GalP (galP) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a3371)

Predicted SEED Role

"PhaK-like protein" in subsystem Protocatechuate branch of beta-ketoadipate pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTL7 at UniProt or InterPro

Protein Sequence (433 amino acids)

>Pf6N2E2_490 PhaK-like protein (Pseudomonas fluorescens FW300-N2E2)
VSTRVRFSPEHRPNHRTLLNTSPALILLGCSSLSLFLPMTASAEGFVDDAKATLTLRNAY
FNRNFTNPNAAQGKAEEWTQNFILDAKSGFTQGVVGFGVDVLGLYSVKLDGGRGTAGTQL
LPVHDDGRPADDFGRLGVALKAKVSKTELKVGEWMPVLPILRSDDGRSLPQTFRGGQVTS
TEISGLTLYGGQFRANSPRNDASMEDMSMNGRGAFTSDRFNFGGGEYAFNEKRTQVGVWY
AELSDIYQQQYFNLTHSQPIGDWTLGANLGYFTGKENGSALAGDLDNKTAFAMLSAKYGG
NTFYVGLQKVGGDDAWMRVNGTSGGTLANDSYNSSYDNAKEKSWQLRHDFNFAAVGVPGL
TLMNRYISGDNVHTATVDDGKEWGRETELAYTVQSGALKSLNVKWRNASIRRDYSTNEFD
ENRIFISYPLSLL