Protein Info for Pf6N2E2_489 in Pseudomonas fluorescens FW300-N2E2

Annotation: UDP-glucose 4-epimerase (EC 5.1.3.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 12 to 156 (145 residues), 29.7 bits, see alignment E=1.1e-10 PF01370: Epimerase" amino acids 14 to 177 (164 residues), 74.6 bits, see alignment E=2.4e-24 PF01073: 3Beta_HSD" amino acids 15 to 132 (118 residues), 49.9 bits, see alignment E=7e-17 PF13460: NAD_binding_10" amino acids 17 to 122 (106 residues), 29.7 bits, see alignment E=1.7e-10 PF16363: GDP_Man_Dehyd" amino acids 47 to 171 (125 residues), 48.7 bits, see alignment E=2.3e-16 PF07993: NAD_binding_4" amino acids 63 to 180 (118 residues), 29.1 bits, see alignment E=1.7e-10

Best Hits

Swiss-Prot: 83% identical to URODH_PSESM: Uronate dehydrogenase (udh) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 84% identity to pfo:Pfl01_3452)

MetaCyc: 83% identical to uronic acid dehydrogenase subunit (Pseudomonas syringae)
Uronate dehydrogenase. [EC: 1.1.1.203]; 1.1.1.203 [EC: 1.1.1.203]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.203 or 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZV90 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Pf6N2E2_489 UDP-glucose 4-epimerase (EC 5.1.3.2) (Pseudomonas fluorescens FW300-N2E2)
MTTTQIRHPFNRLLLTGAAGGLGKVLRERLKPFARHIRLSDIANMAPAIDESEEVMPCDL
SDKQAVHQLVEGVDAILHFGGVSVERPFEEILGANISGVFHIYEAARKHGVKRVIFASSN
HVIGFYKQDETIDALSPRRPDGYYGLSKSYGEDVASFYFDRYGIETVSIRIGSSFPEPQN
RRMMSTWLSFDDLTQLIECSLYTPKVGHTVVYGMSANRDVWWDNSHAAHLGYQPKDTSEI
FRAKVEAQPMPAADDPAMVYQGGAFVAAGPFDD