Protein Info for Pf6N2E2_4889 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details amino acids 372 to 392 (21 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 358 (339 residues), 152.9 bits, see alignment E=1.7e-48 amino acids 222 to 397 (176 residues), 49.2 bits, see alignment E=5.6e-17 PF00083: Sugar_tr" amino acids 51 to 188 (138 residues), 29.1 bits, see alignment E=7.3e-11 PF21987: YajR_YAM" amino acids 401 to 456 (56 residues), 35.7 bits, see alignment 8.6e-13

Best Hits

Swiss-Prot: 54% identical to YAJR_ECOLI: Inner membrane transport protein YajR (yajR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a5068)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2I7 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Pf6N2E2_4889 Putative transport protein (Pseudomonas fluorescens FW300-N2E2)
MQDPHSERMSRGETRAASGLALVFAFRMLGMFMVLPVLATYGMDLAGATPALIGLAIGAY
GLTQAIFQIPFGVISDRIGRRPVIYLGLIIFALGSVLAANADSIWGVIAGRILQGAGAIS
AAVMALLSDLTREQHRTKAMAMIGMTIGLSFAVAMVVGPLLTRAFGLSGLFLATGAMALV
GILIVAFMVPRSTGPLQHRESGVARQALIPTLKHPDLLRLDLGIFVLHAMLMSSFVALPL
ALVEKAGLPKEQHWWVYLTALLISFFAMIPFIIYGEKRRKMKRVLLGAVMTLMLTELFFW
QFGDSLRALVIGTVVFFTAFNLLEASLPSLISKVSPAGGKGTAMGVYSTSQFLGSALGGI
LGGWLFQHGGLSVVFLGCAALAALWLAFAVTMREPPYVTSLRLPLSPEAIREAGLTERLK
AVVGVTDAVVVADEAAVYIKLDTELLDRATLERLVNNPAPTTCEA