Protein Info for Pf6N2E2_4873 in Pseudomonas fluorescens FW300-N2E2

Annotation: SSU ribosomal protein S8p (S15Ae)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 PF00410: Ribosomal_S8" amino acids 1 to 104 (104 residues), 127.8 bits, see alignment E=1.2e-41

Best Hits

Swiss-Prot: 99% identical to RS8_PSEF5: 30S ribosomal protein S8 (rpsH) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02994, small subunit ribosomal protein S8 (inferred from 91% identity to pau:PA14_08990)

Predicted SEED Role

"SSU ribosomal protein S8p (S15Ae)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (104 amino acids)

>Pf6N2E2_4873 SSU ribosomal protein S8p (S15Ae) (Pseudomonas fluorescens FW300-N2E2)
MPSSTLKVAVAKVLKDEGYIAGYQISSEIKPLLSIELKYFEGRPVIEEVKRVSRPGLRQY
KSVEDLPKVRGGLGVSIVSTNKGVMTDRAARAAGVGGEVLCTVF