Protein Info for Pf6N2E2_4872 in Pseudomonas fluorescens FW300-N2E2
Annotation: SSU ribosomal protein S14p (S29e) @ SSU ribosomal protein S14p (S29e), zinc-independent
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to RS14_PSEF5: 30S ribosomal protein S14 (rpsN) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
KEGG orthology group: K02954, small subunit ribosomal protein S14 (inferred from 93% identity to psb:Psyr_4535)MetaCyc: 65% identical to 30S ribosomal subunit protein S14 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"SSU ribosomal protein S14p (S29e) @ SSU ribosomal protein S14p (S29e), zinc-independent"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C1ZPK6 at UniProt or InterPro
Protein Sequence (101 amino acids)
>Pf6N2E2_4872 SSU ribosomal protein S14p (S29e) @ SSU ribosomal protein S14p (S29e), zinc-independent (Pseudomonas fluorescens FW300-N2E2) MAKKSMKNRELKRQLTVAKYATKRAALKAIIVDLNASPEARWEATVALQKQPRDASASRM RNRCRLTGRPHGVYRKFGLGRNMLRQAAMRGDVPGLVKASW