Protein Info for Pf6N2E2_4871 in Pseudomonas fluorescens FW300-N2E2

Annotation: LSU ribosomal protein L5p (L11e)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF00281: Ribosomal_L5" amino acids 24 to 80 (57 residues), 92.1 bits, see alignment E=2.1e-30 PF00673: Ribosomal_L5_C" amino acids 84 to 177 (94 residues), 139 bits, see alignment E=4.7e-45

Best Hits

Swiss-Prot: 99% identical to RL5_PSEF5: 50S ribosomal protein L5 (rplE) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02931, large subunit ribosomal protein L5 (inferred from 94% identity to avn:Avin_06370)

MetaCyc: 68% identical to 50S ribosomal subunit protein L5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L5p (L11e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0D0MVI8 at UniProt or InterPro

Protein Sequence (179 amino acids)

>Pf6N2E2_4871 LSU ribosomal protein L5p (L11e) (Pseudomonas fluorescens FW300-N2E2)
MARLKEIYRKEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAIGDKKVIEHAVADLEKI
TGQKVVVTYARKSIAGFKVREGWPIGVKVTLRRERMYEFLDRLLSISLPRVRDFRGLNAK
SFDGRGNYSMGVKEQIIFPEIDYDKIDALRGLDITLTTTARTDDEGRALLRAFKFPFRN