Protein Info for Pf6N2E2_4856 in Pseudomonas fluorescens FW300-N2E2

Annotation: Translation elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 TIGR00484: translation elongation factor G" amino acids 1 to 661 (661 residues), 1087.4 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 3 to 249 (247 residues), 149 bits, see alignment E=3.8e-47 TIGR00231: small GTP-binding protein domain" amino acids 6 to 149 (144 residues), 71.8 bits, see alignment E=5.7e-24 PF22042: EF-G_D2" amino acids 278 to 361 (84 residues), 59.8 bits, see alignment E=7e-20 PF03144: GTP_EFTU_D2" amino acids 293 to 360 (68 residues), 67.9 bits, see alignment E=2.5e-22 PF14492: EFG_III" amino acids 373 to 447 (75 residues), 118.8 bits, see alignment E=2.5e-38 PF03764: EFG_IV" amino acids 448 to 567 (120 residues), 148.4 bits, see alignment E=2.4e-47 PF00679: EFG_C" amino acids 570 to 656 (87 residues), 102.4 bits, see alignment E=3.3e-33

Best Hits

Swiss-Prot: 98% identical to EFG_PSEPF: Elongation factor G (fusA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02355, elongation factor G (inferred from 98% identity to pfo:Pfl01_5082)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A4F6 at UniProt or InterPro

Protein Sequence (662 amino acids)

>Pf6N2E2_4856 Translation elongation factor G (Pseudomonas fluorescens FW300-N2E2)
MGEVHDGAATTDWMVQEQERGITITSAAITAFWKGSEKQYAHEHRFNVIDTPGHVDFTIE
VERSLRVLDGAVVVFCGTSGVEPQSETVWRQANKYGVPRLVYVNKMDRAGANFLRVIAQI
KQRLGHTPVPIQLAIGSEDNFQGQIDLINMQAVYWNDSDKGMVPVRKEIPAELLEEAEQW
RSNMVEAAAEASEELMNKYLEGEELTNEEIKAALRQRTIAGEIVLAVCGSSFKNKGVPLV
LDAVIDFLPAPTDIPAIKGSNPDNEEEEMERHASDDEPFAALAFKIATDPFVGTLTFVRV
YSGVLASGDGVINSVKGKKERVGRMVQMHANAREEIKEVRAGDIAALIGMKDVTTGETLC
NADKPIILVRMDFPEPVISVAVEPKTKDDQEKMGIALGKLAQEDPSFRVKTDEETGQTII
SGMGELHLDILVDRMRREFNVEANIGKPQVSYRERITKSCEIEGKFVRQSGGRGQFGHCW
IRFAPADEGQEGLQFLNEVVGGVVPKEYIPAIQKGIEEQMKNGVVAGYPLIGLKATVFDG
SYHDVDSNEMAFKVAASMATKQLAQKGGGELLEPIMAVEVVTPEDYMGDVMGDLNRRRGM
ILGMEDTVSGKVIRAEVPLGEMFGYATDVRSMSQGRASYSMEFKKYNTAPSHIVETVTKK
QG