Protein Info for Pf6N2E2_4841 in Pseudomonas fluorescens FW300-N2E2

Annotation: Biotin operon repressor / Biotin-protein ligase (EC 6.3.4.15)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF08279: HTH_11" amino acids 29 to 83 (55 residues), 40.8 bits, see alignment 2.4e-14 TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 106 to 341 (236 residues), 212.5 bits, see alignment E=3.2e-67 PF03099: BPL_LplA_LipB" amino acids 111 to 234 (124 residues), 73.6 bits, see alignment E=2.3e-24 PF02237: BPL_C" amino acids 298 to 342 (45 residues), 24.3 bits, see alignment 3.7e-09

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 97% identity to pba:PSEBR_a5102)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A4J9 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Pf6N2E2_4841 Biotin operon repressor / Biotin-protein ligase (EC 6.3.4.15) (Pseudomonas fluorescens FW300-N2E2)
LPAGKSFCVSMQLSCAWLSCGPHYQGAVRMLTLLKLLKDGRFHSGQALGAALGISRSAVW
KQLQHLEAEIGLSVHKVRGRGYQLAKPLVLLDAAEICAKGLHEWPVHIFDAIDSTNAEAL
RLIERGAAAPFMVLAERQIAGRGRRGRKWVSPFAENLYHSLVLRIDGGMRQIEGLSLVVG
LAVMHALRDMGIAEAGLKWPNDVLVGEKKIAGILLELVGDPADVCHVVLGVGINVNMQST
DEVDQQWTSMSLEAGRDFDRNELVARLGAKLQHYLRLHHASGFAAIQSEWEQYHLWQGRA
VSLIAGVNKIDGIVLGIDHQGALRLKVDGVEKNFSGGELSLRLRDDS