Protein Info for Pf6N2E2_482 in Pseudomonas fluorescens FW300-N2E2

Annotation: Transcriptional regulator BkdR of isoleucine and valine catabolism operon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF13412: HTH_24" amino acids 4 to 51 (48 residues), 66.6 bits, see alignment E=1.7e-22 PF13404: HTH_AsnC-type" amino acids 4 to 45 (42 residues), 54.3 bits, see alignment E=1.4e-18 PF01037: AsnC_trans_reg" amino acids 68 to 150 (83 residues), 93.9 bits, see alignment E=6.5e-31

Best Hits

Swiss-Prot: 84% identical to BKDR_PSEPU: Bkd operon transcriptional regulator (bkdR) from Pseudomonas putida

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a3377)

Predicted SEED Role

"Transcriptional regulator BkdR of isoleucine and valine catabolism operon" in subsystem Isoleucine degradation or Valine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZU57 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Pf6N2E2_482 Transcriptional regulator BkdR of isoleucine and valine catabolism operon (Pseudomonas fluorescens FW300-N2E2)
MRKLDRTDIGILNSLQENARITNADLARSVNLSPTPCFNRVRAMEELGVIREQVTLLDAD
MLGLHVNVFIHVSLEKQVEEALQHFEEAISDRPEVMECYLMAGDPDYLIRVLVPTIQSLE
RFMMDFLTKVPGVANIRSSFALKQVRYKTALPLPANGLTLGT