Protein Info for Pf6N2E2_4802 in Pseudomonas fluorescens FW300-N2E2

Annotation: Thiosulfate sulfurtransferase GlpE (EC 2.8.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF00581: Rhodanese" amino acids 9 to 97 (89 residues), 71 bits, see alignment E=5e-24

Best Hits

Swiss-Prot: 90% identical to GLPE_PSEF5: Thiosulfate sulfurtransferase GlpE (glpE) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02439, thiosulfate sulfurtransferase [EC: 2.8.1.1] (inferred from 99% identity to pba:PSEBR_a5141)

MetaCyc: 49% identical to thiosulfate sulfurtransferase GlpE (Escherichia coli K-12 substr. MG1655)
Thiosulfate sulfurtransferase. [EC: 2.8.1.1]; 2.8.1.- [EC: 2.8.1.1]

Predicted SEED Role

"Thiosulfate sulfurtransferase GlpE (EC 2.8.1.1)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (EC 2.8.1.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1

Use Curated BLAST to search for 2.8.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A266 at UniProt or InterPro

Protein Sequence (109 amino acids)

>Pf6N2E2_4802 Thiosulfate sulfurtransferase GlpE (EC 2.8.1.1) (Pseudomonas fluorescens FW300-N2E2)
MSEFKRIPPEQAQALREQGAVVVDVRDPATFAASHISGSRHLDNHSISDFIRAADLDAPT
VVVCYHGNSSQSAAAYLVSQGFSDVYSLDGGFELWRATYPSETAQDNHE