Protein Info for Pf6N2E2_4776 in Pseudomonas fluorescens FW300-N2E2

Annotation: Coenzyme PQQ synthesis protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 813 TIGR02110: coenzyme PQQ biosynthesis protein PqqF" amino acids 11 to 714 (704 residues), 778.9 bits, see alignment E=3.2e-238 PF00675: Peptidase_M16" amino acids 19 to 151 (133 residues), 79.9 bits, see alignment E=4.9e-26 PF05193: Peptidase_M16_C" amino acids 181 to 313 (133 residues), 43.2 bits, see alignment E=1.1e-14 amino acids 634 to 730 (97 residues), 23.2 bits, see alignment E=1.5e-08 PF22454: PQQ_syn_pqqF_N_2" amino acids 252 to 333 (82 residues), 29.9 bits, see alignment E=1.3e-10 PF22455: PqqF_C_3" amino acids 460 to 586 (127 residues), 88.6 bits, see alignment E=8.9e-29 PF22456: PqqF-like_C_4" amino acids 656 to 755 (100 residues), 96.4 bits, see alignment E=2.3e-31

Best Hits

KEGG orthology group: None (inferred from 93% identity to pba:PSEBR_a5165)

Predicted SEED Role

"Coenzyme PQQ synthesis protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A4G3 at UniProt or InterPro

Protein Sequence (813 amino acids)

>Pf6N2E2_4776 Coenzyme PQQ synthesis protein F (Pseudomonas fluorescens FW300-N2E2)
MPAPDSLRPHTETLANGLRVTLRHVPGLKRSAAVLRVAAGSHDAPLAWPGLAHLLEHLFF
LGTERFPAGENLMAYVQRHGGQVNARTSERTTDFFFELPPATFAEGLERLGDMLTHPRLD
EADQLREREVLHAEFIAWSQDAAAQRQLALHDGLSATHPLRGFHAGNRDSLAVAQSEFQS
ALHDFYRRFYQSGQMTLSLAGPQSIDALKALAEQFDSHLPAGEALARPAPPSLMASSPTS
YQQAREGCLDLLFAFEDLPAASRQALDFLCMWLNSSKPGGLLATLRQRGLADSLKATALY
EFAGQALLHLEFKHANAPAAAQIQPLLHDWLGFFAAQDDWAPLRQEFTARLQRRQETGSA
LQVARWDGEGRDGPLLANDLVRLREILRQLHPADNVVEPWQLPAPNPFLQTPSEAPRAGL
IRGQTSAHRGLRTFAQDRSRGRRERSPMQFSQALPDNGREGAVYLRWQLTTQTPLDFQSR
LDRHLQDVREDARQAGVDVSFQRSGYQWLLKLVGLQAPIPLVLEHALTKLAQPLPMALAS
QEPPPMPIRHLLKALPDHCHPNRQASALPMPDSDQSVWTTARWDGLCIGLAAATQGALGP
ALARVPGIAGDEASLAPAPRGQRLWHTLQTHGEESAVLLFCPTATPTLADEAAWGLLAQL
CQTPFYQRLRVELQLGYAVFSGLKQIDGQTGILFGVQSPSLSATQLSAHIEQFLAGLPAL
LQQLDDVSLTGQQQALAAQLQSTALPCAQAAELLWQGKLAGHPSDYLEQLSAAIVYLDRT
QLQRAAQRLIEAEGGWYCLSNGACPGERWQAPQ