Protein Info for Pf6N2E2_4772 in Pseudomonas fluorescens FW300-N2E2

Annotation: Coenzyme PQQ synthesis protein E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 TIGR02109: coenzyme PQQ biosynthesis enzyme PqqE" amino acids 19 to 379 (361 residues), 613.3 bits, see alignment E=1.3e-188 PF04055: Radical_SAM" amino acids 30 to 186 (157 residues), 93.9 bits, see alignment E=1.9e-30 PF13353: Fer4_12" amino acids 33 to 127 (95 residues), 27.5 bits, see alignment E=5.2e-10 PF13186: SPASM" amino acids 257 to 322 (66 residues), 34.3 bits, see alignment E=3.5e-12 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 264 to 349 (86 residues), 29.3 bits, see alignment E=9.2e-11

Best Hits

Swiss-Prot: 94% identical to PQQE_PSEF5: PqqA peptide cyclase (pqqE) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K06139, pyrroloquinoline quinone biosynthesis protein E (inferred from 98% identity to pba:PSEBR_a5169)

MetaCyc: 75% identical to glutamate Cgamma--tyrosine C3 ligase (Klebsiella pneumoniae)
RXN-11176 [EC: 1.21.98.4]

Predicted SEED Role

"Coenzyme PQQ synthesis protein E" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.21.98.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2A1 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Pf6N2E2_4772 Coenzyme PQQ synthesis protein E (Pseudomonas fluorescens FW300-N2E2)
VHSTGSNLSETTGLPPKPEVGLPLWLLAELTYRCPLQCPYCSNPLDFAEQGQELSTEQWF
KVFREAREMGAAQLGFSGGEPLVRQDLAELIGEARRLGFYTNLITSGIGLTEQKISDFKK
AGLDHIQISFQASDEQVNNLLAGSKKAFAQKLEMARAVKAHGYPMVLNFVTHRHNIDKID
RIIELCIALEADFVELATCQFYGWAQLNRVGLLPTREQLVRAERVTNEYRAKLEAEGNPC
KLIFVTPDYYEERPKGCMNGWGSIFLTVTPDGTALPCHGARQLPVQFPNVRDHSMQHIWY
DSFGFNRFRGYDWMPEPCRSCDEKEKDFGGCRCQAFMLTGDASNADPVCSKSAHHGVILQ
AREDAEHATQTIEQLAFRNERNSRLIAKG