Protein Info for Pf6N2E2_4767 in Pseudomonas fluorescens FW300-N2E2

Annotation: GGDEF domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 202 to 218 (17 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 249 to 357 (109 residues), 80.3 bits, see alignment E=6.7e-27 PF00990: GGDEF" amino acids 251 to 418 (168 residues), 97.1 bits, see alignment E=4.9e-32

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a5174)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A243 at UniProt or InterPro

Protein Sequence (438 amino acids)

>Pf6N2E2_4767 GGDEF domain protein (Pseudomonas fluorescens FW300-N2E2)
LISRVGALPLPRSSAVRFSHFLPSLLLLLAGLAAAYVKDLNVFFTSLFNVLPTLVLLLGG
AYCAVYRRQRELFLMVTVYIAYFLLDTQTDFYRDNGKVREDAAVVFHLVCLLLPLLFGLF
AAWQERTHLFQDMVARFAVLLVFGSVALALEQSYPQALLLWLSEIRWPALHGAWMSLIQL
SYPMFAAAFLLLAWQYWRNPRPLHAAQLVGVLGLFWMLPKTFILPFTLNIMCSQVMLMIA
AAVAHEAYQMAFRDELTGLPGRRALNERMQRLGRNYVLAMSDVDHFKKFNDTHGHDVGDQ
VLRLVASKLSKIGGGGRAYRYGGEEFALVFAGKTIDECMPHLEVIRQSIETYAIQLRNPD
SRPQDDQQGRQRRSGAGASSVSVTVSIGVAERLEQRTPEEVLKSADQALYNAKGAGRNCV
IAFGQNRRGAVRMETAAG