Protein Info for Pf6N2E2_4757 in Pseudomonas fluorescens FW300-N2E2

Annotation: DNA-binding domain of ModE / Molybdate-binding domain of ModE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 TIGR00637: ModE molybdate transport repressor domain" amino acids 15 to 103 (89 residues), 104.1 bits, see alignment E=3.4e-34 PF00126: HTH_1" amino acids 17 to 79 (63 residues), 42.7 bits, see alignment E=6.7e-15 TIGR00638: molybdenum-pterin binding domain" amino acids 113 to 178 (66 residues), 59.6 bits, see alignment E=2.3e-20 PF03459: TOBE" amino acids 115 to 176 (62 residues), 55.6 bits, see alignment E=7.6e-19 amino acids 190 to 250 (61 residues), 24.3 bits, see alignment E=4.6e-09

Best Hits

KEGG orthology group: K02019, molybdate transport system regulatory protein (inferred from 94% identity to pba:PSEBR_a5183)

Predicted SEED Role

"DNA-binding domain of ModE / Molybdate-binding domain of ModE" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3H9 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Pf6N2E2_4757 DNA-binding domain of ModE / Molybdate-binding domain of ModE (Pseudomonas fluorescens FW300-N2E2)
MSLPTLLAQHIARRPQRIALLQHIAEQGSITRAAKSAGLSYKAAWDAIDELNNLADQPLV
ERSVGGKGGGGARLSEEGQRVLRLYLRLQALQTQLLEASEDADDLGLLSRLMLRTSARNQ
LYGKVLGIEAQGHNDRVRLELARGLVIEAQITHDSTLRLELDVGTNVVALIKAGWLELHP
VEQVEKPRINTLRGMIEQVDTAEDGPSEVRISLPNGQTLCALADPLELQKQHLEGGSPVQ
VTFSATNVLLGTPL