Protein Info for Pf6N2E2_4716 in Pseudomonas fluorescens FW300-N2E2

Annotation: Membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 116 to 146 (31 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details PF05857: TraX" amino acids 8 to 230 (223 residues), 170.2 bits, see alignment E=3e-54

Best Hits

KEGG orthology group: None (inferred from 89% identity to pba:PSEBR_a5216)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2D3 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Pf6N2E2_4716 Membrane protein, putative (Pseudomonas fluorescens FW300-N2E2)
MSRRDGALDLLKWLALLSMVLDHLRYVGFSVDWLYVPGRLAFPWFCLAMAANLGRGGTHV
APWRYLGWLLLFSAVSEIPYRLFIPDPTTLNVMPTLVLGLLVARCWQTPTLEARCLAAMA
LLLAALFSSRLMFGFFGVLLPLAALLVLRRPWYFAALPGVVCVAANQWRVLYGAAWLGDG
VALWGLLACLIAPGLGLVVLRQAGRFHPPAMRRWAYGLYPAHFLVLLVVRQIAA