Protein Info for Pf6N2E2_4702 in Pseudomonas fluorescens FW300-N2E2

Annotation: DgcA Dimethylglycine demethylase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 PF00724: Oxidored_FMN" amino acids 6 to 341 (336 residues), 221.8 bits, see alignment E=6.2e-69 PF01134: GIDA" amino acids 392 to 422 (31 residues), 23.9 bits, see alignment (E = 8.7e-09) PF00070: Pyr_redox" amino acids 392 to 426 (35 residues), 26.7 bits, see alignment (E = 2.7e-09) PF07992: Pyr_redox_2" amino acids 392 to 641 (250 residues), 42.7 bits, see alignment E=2e-14 PF01266: DAO" amino acids 392 to 434 (43 residues), 28.7 bits, see alignment 4.1e-10 PF12831: FAD_oxidored" amino acids 393 to 436 (44 residues), 39.6 bits, see alignment 1.7e-13 PF00890: FAD_binding_2" amino acids 393 to 433 (41 residues), 29.7 bits, see alignment 1.7e-10 PF13450: NAD_binding_8" amino acids 395 to 434 (40 residues), 36.5 bits, see alignment 1.9e-12

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a5226)

MetaCyc: 80% identical to N,N-dimethylglycine/sarcosine dehydrogenase (ferredoxin) (Chromohalobacter salexigens)
RXN-22743 [EC: 1.5.7.3]; 1.5.7.3 [EC: 1.5.7.3]

Predicted SEED Role

"DgcA Dimethylglycine demethylase subunit A"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2C5 at UniProt or InterPro

Protein Sequence (686 amino acids)

>Pf6N2E2_4702 DgcA Dimethylglycine demethylase subunit A (Pseudomonas fluorescens FW300-N2E2)
MAFEAMFQPIQIGKLTIRNRVLSTAHAEVYATDGGMTTDRYVKYYEEKAKGGIGLAICGG
SSVVAIDSPQEWWSSVNLSTDRIIPHFQNLADAMHKHGAKIMIQITHMGRRSRWDGFNWP
TLMSPSGVREPVHRATCKTIEPEEIWRVIGNYAQAARRAKAGGLDGVELSAVHQHMIDQF
WSPRVNKRTDEWGGSFEGRMKFGLEVLKAVRAEVGDDFCVGMRICGDEFHPDGLSHEDMK
QIAKYYDDTGMLDFIGVVGSGCDTHNTLANVIPNMSYPPEPFLHLAAGIKEVVKVPVLHA
QNIKDPNQATRILEGGYVDMVGMTRAHIADPHLIAKIKMGQIDQIKQCVGANYCIDRQYQ
GLDVLCIQNAATSREYMGVPHIIEKSTGPKRKVVVVGAGPAGMEAARVAAERGHDVTLFE
KKEFIGGQITTASKAPQRDQIAGITRWFQLELARLKVDLRLGVAADAATIMDLRPDVVVL
AVGGHPFLEQNEHWGAAEGLVVSSWDVLDGKVAPGKNVLVYDTICEFTGMSVADFLADKG
SQVEIVTDDIKPGVAIGGTSFPTYYRSMYPKEVIMTGDMMLEKVYREGDKLVAVLENEYT
GAKEERVVDQVVVENGVRPDEEIYYALKEGSRNKGQIDVEALFAIKPQPCLEQSGDGYLL
FRIGDCVAQRNTHAAIYDALRLCKDF