Protein Info for Pf6N2E2_465 in Pseudomonas fluorescens FW300-N2E2

Annotation: Probable transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details PF07077: DUF1345" amino acids 33 to 202 (170 residues), 196.1 bits, see alignment E=1.9e-62

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a3394)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZT27 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Pf6N2E2_465 Probable transmembrane protein (Pseudomonas fluorescens FW300-N2E2)
MPFLARTHPRLSSATVLGLAVGILVPVDSIISKILIGWNVGVWTYLVLMSWLTVRAKAPD
VRRIAEIEDENAGLVLLVVCIAALASLATITFELAGSRDLDAAGKLLHYGFTAMTVIGSW
LLIGVIFSVHYARLYYTWEGKEPALRFAEGLTTPNYWDFLYFSFTIGVAVQTSDVGVATR
QLRKIVLAQSLIGFVFNTAILGFSINIAAGLFG