Protein Info for Pf6N2E2_4629 in Pseudomonas fluorescens FW300-N2E2

Annotation: COG1272: Predicted membrane protein hemolysin III homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 56 (18 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details PF03006: HlyIII" amino acids 2 to 197 (196 residues), 157.9 bits, see alignment E=1.6e-50 TIGR01065: channel protein, hemolysin III family" amino acids 5 to 204 (200 residues), 216.9 bits, see alignment E=1.1e-68

Best Hits

KEGG orthology group: K11068, hemolysin III (inferred from 98% identity to pba:PSEBR_a5296)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0A8 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Pf6N2E2_4629 COG1272: Predicted membrane protein hemolysin III homolog (Pseudomonas fluorescens FW300-N2E2)
MYHGERLNAWTHLVGAVAAFIGAVWLLVIAGMAGDPWKIVSVAIYGFTLLVLYSASTVYH
SVRGRKKAIMQKVDHFSIYLLIAGSYTPFCLVTLRGPWGWTLFGIVWGLALIGILQEIKP
RSEARILSIVIYAVMGWIVLVAVKPLLAALGNAGFAWLASGGVLYTVGIIFFALDHRLRH
AHGIWHLFVIAGSLLHFVAILFYVL