Protein Info for Pf6N2E2_4584 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 TIGR02673: cell division ATP-binding protein FtsE" amino acids 1 to 214 (214 residues), 282 bits, see alignment E=1.5e-88 PF00005: ABC_tran" amino acids 18 to 165 (148 residues), 121.4 bits, see alignment E=4.7e-39 PF13304: AAA_21" amino acids 122 to 201 (80 residues), 32.4 bits, see alignment E=9.7e-12

Best Hits

Swiss-Prot: 55% identical to FTSE_ECOLI: Cell division ATP-binding protein FtsE (ftsE) from Escherichia coli (strain K12)

KEGG orthology group: K09812, cell division transport system ATP-binding protein (inferred from 100% identity to pba:PSEBR_a5337)

MetaCyc: 45% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A411 at UniProt or InterPro

Protein Sequence (223 amino acids)

>Pf6N2E2_4584 Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1) (Pseudomonas fluorescens FW300-N2E2)
MIRFEQVGKRYPNGHVGLHELSFRVRRGEFLFVTGHSGAGKSTLLRLLLAMERPSTGKLL
LAGQDLSTISNAQIPYLRRQIGVVFQNHQLLFDRTVFNNVALPLQILGLSKAEIIKRVDS
ALERVALSDKTDLYPGDLSTGQQQRVGIARAIVHRPALLLADEPTGNLDPRLAAEIMGVF
EDINRLGTSVLIASHDLALIARMRHRMLTLQRGRLIGDGEAGV