Protein Info for Pf6N2E2_4579 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD" amino acids 9 to 198 (190 residues), 173.1 bits, see alignment E=2.7e-55 PF03602: Cons_hypoth95" amino acids 19 to 196 (178 residues), 188.2 bits, see alignment E=5.8e-60

Best Hits

Swiss-Prot: 50% identical to RSMD_ECOLI: Ribosomal RNA small subunit methyltransferase D (rsmD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a5341)

MetaCyc: 50% identical to 16S rRNA m2G966 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6515 [EC: 2.1.1.171]

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.171

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A455 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Pf6N2E2_4579 Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-) (Pseudomonas fluorescens FW300-N2E2)
MARPSNSSKKPVHNGVNQLRIIGGEWRSRRLSFPDAPGLRPTPDRVRETLFNWLAPYVAG
ARVLDPFAGSGALFLEALSRGASMGQALDASNLAVSSLKEHLGTLRCTVGQVQTADALRY
LDSQPATPFDLVFLDPPFNQNLLPTVCTLLEERQWLAEDAWVYTESETAPSTLGLPGNWR
LHREQKSGRVYYALWQRLAKDID