Protein Info for Pf6N2E2_4565 in Pseudomonas fluorescens FW300-N2E2

Annotation: Multidrug resistance transporter, Bcr/CflA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 51 to 69 (19 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 216 to 239 (24 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details amino acids 371 to 390 (20 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 357 (337 residues), 130.8 bits, see alignment E=5.9e-42 PF00083: Sugar_tr" amino acids 44 to 152 (109 residues), 45.4 bits, see alignment E=5.5e-16

Best Hits

KEGG orthology group: None (inferred from 86% identity to pba:PSEBR_a5354)

Predicted SEED Role

"Multidrug resistance transporter, Bcr/CflA family" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A064 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Pf6N2E2_4565 Multidrug resistance transporter, Bcr/CflA family (Pseudomonas fluorescens FW300-N2E2)
MTDPQNHLATRKPATVGLLLTLTLLGVFPIDVVLPSFPALSEQFERPSSDIALSVSLFAV
GIALSQLLVGPLSDVMGRKNLLLIGISVSAVGATGCVLTDGYWSFLFFRVVQALGCGCFV
LSQALIQDLFTGGEQQRLRIFLVTCGGIFISVSPLAGTGLQSWMGWRGSFLVFAALAVGV
FAGASLLLKPTPAGRPRQRLDFIASYRNVCGDFSFMTYWLTSALAFSCHFSFIVISPLLL
IDQLQLSPEAFSWALLGYGLAYIGGGAVATVLSNRIAPQTQIITGLGLILAAGILMLGLS
SQLGLSITTLLLPMIVCTAGTTIARAAAHTLAMNRFPEQAGTSASAGSVLIFIVGGLTSA
AISLTPLDRQMTLALCLMLLSALGLGLNSLARHRHRALLAG