Protein Info for Pf6N2E2_4561 in Pseudomonas fluorescens FW300-N2E2

Annotation: Dihydrofolate reductase (EC 1.5.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00186: DHFR_1" amino acids 7 to 168 (162 residues), 186.7 bits, see alignment E=1.2e-59

Best Hits

Swiss-Prot: 42% identical to DYR_MYCTU: Dihydrofolate reductase (folA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00287, dihydrofolate reductase [EC: 1.5.1.3] (inferred from 96% identity to pba:PSEBR_a5358)

Predicted SEED Role

"Dihydrofolate reductase (EC 1.5.1.3)" in subsystem Folate Biosynthesis (EC 1.5.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.3

Use Curated BLAST to search for 1.5.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A328 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Pf6N2E2_4561 Dihydrofolate reductase (EC 1.5.1.3) (Pseudomonas fluorescens FW300-N2E2)
MNKTLPLSLIAALGENRVIGVDNSMPWHLPGDFKYFKATTLGKPIIMGRKTWDSLGRPLP
GRLNIVVSRQPGLVLEGAEVFSTLEAAVARAEAWALEQGVDELMLIGGAQLYAQALAQAD
RLYLTRVALSPEGDAWFPEFDSSQWTLVSNQPNPAEGDKPAYSFEVWEKR