Protein Info for Pf6N2E2_4553 in Pseudomonas fluorescens FW300-N2E2

Annotation: Nitrogen regulation protein NtrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF00158: Sigma54_activat" amino acids 23 to 175 (153 residues), 198.1 bits, see alignment E=3e-62 PF14532: Sigma54_activ_2" amino acids 24 to 180 (157 residues), 44 bits, see alignment E=1e-14 PF07728: AAA_5" amino acids 33 to 149 (117 residues), 34.3 bits, see alignment E=7.7e-12 PF01078: Mg_chelatase" amino acids 84 to 158 (75 residues), 22.4 bits, see alignment E=2.5e-08 PF25601: AAA_lid_14" amino acids 181 to 238 (58 residues), 40.6 bits, see alignment E=6.5e-14 PF02954: HTH_8" amino acids 262 to 300 (39 residues), 36.2 bits, see alignment 1.4e-12

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a5366)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZKZ0 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Pf6N2E2_4553 Nitrogen regulation protein NtrC (Pseudomonas fluorescens FW300-N2E2)
MQKLLCAALSNPYKEDALNLEAFVQCVAPLMIDVLLRGETGTGKDTLAEKIHRMSGCSGK
FVAINCAAIPETLAESQLFGANTGAFTGASQNRAGFVEAAHNGTLYLDEIDSMPLGLQAK
LLRVLESRTVQRLGSTQNIPVNMRVIASAQCPLGEMVERGEFRRDLYFRLNIISLKLPPL
RSRKERIVPLFQSLVRREAQALDRPYVAPSPALLRQLLGYAWPGNIRELQSAAKRYVLGL
PALPRAEQLEHSSSTLKLKEHLQQFEKILIEDCMRRHHHCIDKVIAELGIARRTLYYRMK
CLQISTS