Protein Info for Pf6N2E2_4536 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details TIGR01102: type III secretion apparatus protein, YscR/HrcR family" amino acids 12 to 212 (201 residues), 276.6 bits, see alignment E=6.5e-87 PF00813: FliP" amino acids 18 to 212 (195 residues), 210.2 bits, see alignment E=1.4e-66

Best Hits

Swiss-Prot: 72% identical to HRPW_PSESY: Harpin secretion protein HrpW (hrpW) from Pseudomonas syringae pv. syringae

KEGG orthology group: K03226, type III secretion protein SctR (inferred from 98% identity to pba:PSEBR_a5382)

Predicted SEED Role

"Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GT18 at UniProt or InterPro

Protein Sequence (217 amino acids)

>Pf6N2E2_4536 Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components) (Pseudomonas fluorescens FW300-N2E2)
MSFQGVDPFLLALFIGGISLVPLLLIICSAFLKIAIVLTITRNAIGVQQVPPNMALYAIA
LAATLFIMAPVGHNIAEQLKEQPLDFSSTEALQGSALNAVKPLQAFMSRNTNPDILAHLL
ENTQRMWPKERAEQASRDDLMLLIPAFMLSELEAGFQMGFLIYIPFIVIDLIVSNLLLAL
GMQMVAPMTISLPLKLLIFVLVQGWTQLLDSLFYSYL