Protein Info for Pf6N2E2_4535 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type III secretion inner membrane protein (YscQ,homologous to flagellar export components)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF27361: HrcQa_N" amino acids 14 to 156 (143 residues), 125.2 bits, see alignment E=2.6e-40 TIGR02551: type III secretion apparatus protein, YscQ/HrcQ family" amino acids 117 to 362 (246 residues), 104.6 bits, see alignment E=4.9e-34 PF01052: FliMN_C" amino acids 294 to 363 (70 residues), 43.6 bits, see alignment E=2.4e-15

Best Hits

KEGG orthology group: K03225, type III secretion protein SctQ (inferred from 91% identity to pba:PSEBR_a5383)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A000 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Pf6N2E2_4535 Type III secretion inner membrane protein (YscQ,homologous to flagellar export components) (Pseudomonas fluorescens FW300-N2E2)
MTVHALVLPTVGSEDATARRLLGIGVRLPFEVAGETGLLELTPGGVAAGSTPCVLACAHG
VFTLDEAGAVLSLFGECPVVLPAEPGPDDTWFWSLFQQALSEPLRQVFGFIKPAAGPAVQ
GIACRLDVRVGAARVTSHLEMTGATLLGLLRTDPWQRLAAPVIEGFALRVPLELGHLALA
AGQVATLRPGDVLVPQTPLFDSSGQGLIRLGRHCLQVRVHSRAAPLRLTLLALEETVMST
TADTDILTPDWDDSTGYEPDAQTGEATEHPLSAYAAETEVAPMTEPVAADLPERFDDLPL
ALTIRCGHLHLTLGELRNLAPGAVLQVPGVAPGTAALFYGERALAQGELVEVDGRLGLQI
ARVDVAG