Protein Info for Pf6N2E2_452 in Pseudomonas fluorescens FW300-N2E2

Annotation: Rtn protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details PF12792: CSS-motif" amino acids 42 to 230 (189 residues), 126.7 bits, see alignment E=9e-41 PF00563: EAL" amino acids 263 to 498 (236 residues), 220.3 bits, see alignment E=2.5e-69

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a3409)

Predicted SEED Role

"Rtn protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZU39 at UniProt or InterPro

Protein Sequence (514 amino acids)

>Pf6N2E2_452 Rtn protein (Pseudomonas fluorescens FW300-N2E2)
MPLTATRSHTRPRRALVTLLCGLVPMLSGLAILYMQAERTLAQHTRQTAEELVRQIELML
DNTAQAAHELLPLAGQPCEAVKLALREQVTRRPFVRSTNLIWDNNLYCSSLFGAFEERVN
PSDYHQGSLWLMDGNPVTPNTALLIYRLNEGHQGALATLDGYHLTNVLRLIGRQTRLRLQ
VGPNWLAADGKVRPAPMPGLPVAQHELGSSRYAFNVEAGFDAGETWRYMAREYPPLFSLL
IFFGVVAGTLGHWLQKRASSPSRELQRALEAGEFVPYLQPVVHSDSKRWAGVEVLMRWNH
PKEGLVRPDLFIPFAEHSGLIVPMTRALMQQTMRLLEPLAPHLEAPFHVGINITARHCQD
LALVDDCREFLATFAPGTIALVLELTERELIEPTPVTRQLFDQLRELGVKIALDDFGTGH
SSLAYLRQFNVDFLKIDQSFVAMIGADTLSRHLLDSIIELSGKLGLDMVAEGVETVEQSD
YLSAHGVNFLQGYLFGRPISGQAFIETLTGLNGS