Protein Info for Pf6N2E2_4499 in Pseudomonas fluorescens FW300-N2E2

Annotation: protein of unknown function DUF86

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 transmembrane" amino acids 113 to 132 (20 residues), see Phobius details PF01934: HepT-like" amino acids 13 to 129 (117 residues), 94.8 bits, see alignment E=1.6e-31

Best Hits

KEGG orthology group: None (inferred from 75% identity to pna:Pnap_0134)

Predicted SEED Role

"protein of unknown function DUF86"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZKT5 at UniProt or InterPro

Protein Sequence (142 amino acids)

>Pf6N2E2_4499 protein of unknown function DUF86 (Pseudomonas fluorescens FW300-N2E2)
MADDVLINKAASIERCIARVREEYEKDPATFATDFTRQDSAVLNIQRACEAALDIGQHLI
RRERLGVPQSSRDVFELLFQSGWVEDGLVKNLKNMVGFRNIAVHDYQALQLPIMVAIITG
HLDDFLAFSAFVLRKDARESAS