Protein Info for Pf6N2E2_4489 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative activity regulator of membrane protease YbbK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 transmembrane" amino acids 7 to 49 (43 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details PF01957: NfeD" amino acids 61 to 147 (87 residues), 58.7 bits, see alignment E=3.2e-20

Best Hits

Swiss-Prot: 40% identical to YBBJ_ECOLI: Inner membrane protein YbbJ (ybbJ) from Escherichia coli (strain K12)

KEGG orthology group: K07340, hypothetical protein (inferred from 99% identity to pba:PSEBR_a5424)

Predicted SEED Role

"Putative activity regulator of membrane protease YbbK" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A009 at UniProt or InterPro

Protein Sequence (149 amino acids)

>Pf6N2E2_4489 Putative activity regulator of membrane protease YbbK (Pseudomonas fluorescens FW300-N2E2)
MWMFLQHLSYWDWLALGVILLILEVFGAGGYLLWIGMAAAAVGVLTFILPQMPWELQFLL
FGLFAIATALYWWQRQRSAVRQSDQPHLNLRGQELIGKVFQVHEAIVDGRGKIKVADSVW
LAKGPESSVGTRVRVVAQEGAVLQVERAD