Protein Info for Pf6N2E2_448 in Pseudomonas fluorescens FW300-N2E2

Annotation: Alkyl hydroperoxide reductase protein F (EC 1.6.4.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 TIGR03140: alkyl hydroperoxide reductase subunit F" amino acids 1 to 515 (515 residues), 801.5 bits, see alignment E=1.4e-245 PF13192: Thioredoxin_3" amino acids 124 to 194 (71 residues), 31.2 bits, see alignment E=5.5e-11 PF07992: Pyr_redox_2" amino acids 212 to 502 (291 residues), 173.1 bits, see alignment E=2.7e-54 PF01134: GIDA" amino acids 213 to 241 (29 residues), 20.4 bits, see alignment (E = 7.1e-08) PF13738: Pyr_redox_3" amino acids 259 to 485 (227 residues), 59.9 bits, see alignment E=7.7e-20 PF00070: Pyr_redox" amino acids 355 to 429 (75 residues), 50.4 bits, see alignment E=8e-17

Best Hits

Swiss-Prot: 86% identical to AHPF_PSEPU: Alkyl hydroperoxide reductase subunit F (ahpF) from Pseudomonas putida

KEGG orthology group: K03387, alkyl hydroperoxide reductase subunit F [EC: 1.6.4.-] (inferred from 98% identity to pba:PSEBR_a3413)

MetaCyc: 66% identical to alkyl hydroperoxide reductase, AhpF component (Escherichia coli K-12 substr. MG1655)
RXN-8506 [EC: 1.5.1.37]; R4-RXN [EC: 1.5.1.37, 1.11.1.26]

Predicted SEED Role

"Alkyl hydroperoxide reductase protein F (EC 1.6.4.-)" in subsystem Thioredoxin-disulfide reductase (EC 1.6.4.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.4.-

Use Curated BLAST to search for 1.11.1.26 or 1.5.1.37 or 1.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YUD7 at UniProt or InterPro

Protein Sequence (520 amino acids)

>Pf6N2E2_448 Alkyl hydroperoxide reductase protein F (EC 1.6.4.-) (Pseudomonas fluorescens FW300-N2E2)
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLKDVASLCDQITLLDNGTDAR
KPSFSLNRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVDVIEQIRSLKGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDERQIMAVPSIYLNGVNF
GQGRMGLEEILAKIDTSGIERQAEKISAKDAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLAVALEEHVKQYDVDIMNLQRADALVPGKAGGL
HEIKFASGASLKAKTVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFDVQLRADAVLQRKLHSLPNVTVITNAQTTEVTGDGQ
KVNGLRYKDRPSGDVRDVELEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDARGETSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA