Protein Info for Pf6N2E2_4472 in Pseudomonas fluorescens FW300-N2E2

Annotation: ABC-type multidrug transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 907 transmembrane" amino acids 557 to 577 (21 residues), see Phobius details amino acids 710 to 735 (26 residues), see Phobius details amino acids 762 to 783 (22 residues), see Phobius details amino acids 791 to 815 (25 residues), see Phobius details amino acids 820 to 842 (23 residues), see Phobius details amino acids 849 to 868 (20 residues), see Phobius details amino acids 880 to 902 (23 residues), see Phobius details PF00005: ABC_tran" amino acids 24 to 172 (149 residues), 97.2 bits, see alignment E=3.3e-31 amino acids 288 to 431 (144 residues), 99.4 bits, see alignment E=6.9e-32 PF13304: AAA_21" amino acids 139 to 196 (58 residues), 28.7 bits, see alignment 3.4e-10 amino acids 390 to 461 (72 residues), 32 bits, see alignment E=3.4e-11 PF12679: ABC2_membrane_2" amino acids 540 to 838 (299 residues), 47.3 bits, see alignment E=4.3e-16 PF12698: ABC2_membrane_3" amino acids 560 to 900 (341 residues), 156.2 bits, see alignment E=3.2e-49 PF01061: ABC2_membrane" amino acids 708 to 870 (163 residues), 66.9 bits, see alignment E=4.7e-22

Best Hits

Swiss-Prot: 54% identical to RBBA_ECOLI: Ribosome-associated ATPase (rbbA) from Escherichia coli (strain K12)

KEGG orthology group: K13926, ribosome-dependent ATPase (inferred from 98% identity to pba:PSEBR_a5439)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1H9 at UniProt or InterPro

Protein Sequence (907 amino acids)

>Pf6N2E2_4472 ABC-type multidrug transport system, permease component (Pseudomonas fluorescens FW300-N2E2)
MSAPAGEALRASGLEHRYGQQVALSDIAFSLPAGTRCGLIGPDGAGKSSLLGLIAGVKKL
QHGQLDVLGASIDDRRHRNTLYRRIAFMPQGLGGNLYPDLSIRENIRFFGTLFGLSRADC
EQRMGTLLLATDLQRFADRPAGKLSGGMKQKLGLCCALIHEPDLLILDEPTTGVDPLSRR
RFWELIEDVRRQRPQLTLLVATAYMEEAEQFEHCLMLDNGRLIAKGLSAELATVTPDGKL
DSAFTHFQGDSGRDVEPLVIPPRSANTADIAIEAHDLTLRFGDFTAVDKVSFAIGRGEIF
GFLGSNGCGKTTTMKVLTGLIPASEGSARLLGNPVNAKDLATRKRVGFMSQSFSLYGELS
ARQNLELHAKLFDLPTTDSRQRIDELIQRFNLQALADQPSGALPLGLRQRLSLAVAVLHR
PEVLILDEPTSGVDPAARDDFWRLLIELSREQGVTIFLSTHFMNEAQRCDRISLMHAGKV
LACDTPAALQAQFNGQTLEAAFVTCLENAQGETQQDAAPVPLDSADAPRDRRGLSLGRLW
AVASREGKELLRDKVRMAFALLGALFMMVVFGFGISLDVEKLAFAAYDQDQSPQSRAYLE
AFRSSRYFEEQPIISDAKELHRRLQRSEIKLALEIPPGFGRDLYAGRQPTVGAWLDGGIP
FRAETSRNYVQAVHQANLEQLAELSSRAPNRQPGATLETRFRYNQDVVSVNAIGPGVMAL
ILAFIPAMLTALGIVREKELGSITNFYATPLTRLEFLLGKQVPYLAVSLINLALLTAMNR
WLFGVPFKGSGLTLAIGGLLYVLATTSMGLLISAFTRTQIAAILGTMIITSLPTIQFSGL
IVPRSSLEGAAAVMGQLFPAGYFLDIAVGTFTKALDLRQLWPQCLALGGFFLGFTGLSLI
MLKKQEA