Protein Info for Pf6N2E2_4456 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative amino acid ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 11 to 107 (97 residues), 106.6 bits, see alignment E=4e-35 PF00528: BPD_transp_1" amino acids 33 to 212 (180 residues), 65 bits, see alignment E=3.8e-22

Best Hits

Swiss-Prot: 36% identical to YECS_SHIFL: L-cystine transport system permease protein YecS (yecS) from Shigella flexneri

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to pba:PSEBR_a5453)

MetaCyc: 36% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Putative amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZKP7 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Pf6N2E2_4456 Putative amino acid ABC transporter, permease protein (Pseudomonas fluorescens FW300-N2E2)
MSDFTFWDVVRNLLTGLQWTLALSLVAFIGGGVIGLLIMVLRISKSALPRNIARTYIELF
QGTPLLMQLFLVFFGVALAGVEISPWMAAAIALTLFTSAYLAEIWRGCVDSISHGQWEAS
ASLALNPLEQLRYVILPQALRIAVAPTVGFSVQVVKGTAVTSIIGFTELTKTGGMLANAT
FEPFMVYGLVALGYFLLCYPLSLSARYLERRLHASA