Protein Info for Pf6N2E2_4447 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cytochrome c family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 transmembrane" amino acids 339 to 363 (25 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details amino acids 409 to 426 (18 residues), see Phobius details amino acids 439 to 461 (23 residues), see Phobius details amino acids 483 to 505 (23 residues), see Phobius details amino acids 512 to 533 (22 residues), see Phobius details amino acids 564 to 582 (19 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 95 to 178 (84 residues), 47.2 bits, see alignment E=3.4e-16 PF00034: Cytochrom_C" amino acids 98 to 180 (83 residues), 47.5 bits, see alignment E=5.5e-16 PF03239: FTR1" amino acids 342 to 542 (201 residues), 74.8 bits, see alignment E=1.2e-24

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 96% identity to pba:PSEBR_a5462)

Predicted SEED Role

"Cytochrome c family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3Y7 at UniProt or InterPro

Protein Sequence (595 amino acids)

>Pf6N2E2_4447 Cytochrome c family protein (Pseudomonas fluorescens FW300-N2E2)
LDYIGADYPATVEAGKVIDEAEYREQLEFTQALEGLVAGWPAKPEKTELVQGIGTLRTAI
TQRQDGGDVARLARQLGAKLAVAYEVSQAPVITPDPTRGAPLYAQNCSVCHGANGAGDGP
AGVGLEPPPANMRDAQRLDRLSLYGIYNTVGMGIEGTDMPAFADQLDDRQRWDLATYIAS
FSADPAAAKSEQVFNLADLARQTPAEVLAAQGPAAAATFRAQRAQPPQVQRGPAQLLDYT
AATLDKSIAAYRAGDHDQAYDLSVAAYLEGFELVESSLDNVDANVRKDTEKSLMAYRQSL
QDGLPVEQAVQRLDAAKAKLKESAGLLGGDGLSWSLSYISGLLILLREGLEAILVLAAIL
AFLRNTGQQSAVRSVNVGWGLALVAGLATWGLAAYVIDVSGAQRELLEGATALFASVMVL
WLGVWMHDRRHAAAWQDYIKSSLVGGGGRFGFAILAFFSVYRELFEVILFYETLWLQAGP
AGHNAVLAGGATALVLLVGLAWVILRGSAKLPLALFFSINAGLLCALSVVFAGHGVKALQ
EAGIFGTHPVAFFEFDWLGIHADAYSLAAQVVAILAIMVLYGRSWVVEKRRVQVS