Protein Info for Pf6N2E2_4437 in Pseudomonas fluorescens FW300-N2E2

Annotation: Twin-arginine translocation protein TatB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

Swiss-Prot: 67% identical to ALGP_PSEAE: Transcriptional regulatory protein AlgP (algP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 80% identity to pba:PSEBR_cmegl98)

Predicted SEED Role

"Twin-arginine translocation protein TatB" in subsystem Twin-arginine translocation system

Sequence Analysis Tools

See A0A160A2V0 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Pf6N2E2_4437 Twin-arginine translocation protein TatB (Pseudomonas fluorescens FW300-N2E2)
MSATKKPVNTPLHLLQQLSGSLLEHLENACSQALADAEKLLAKLEKQRGKAQEKLHKSRT
KLQDAATAGKAKAQAKAKDVVKELEDLLDALKDRQSETRTYILQLKRDAQESLKLAQGVG
RVQEAAGKALSLRAAKPAAVSAKKPAAKPVAAKAPAKVAAKPAAKAPAKAASKPAAKSVA
ASAAKPAAKKPVVKAAAKPATKTAVAKPAAAKPAVKAAAKPAAKPAAKAAAKPAAKTAAA
KPAAKAAVKATAKPAAVKPAAKPAAKPAATKTAAAKPAAKTAAKPVAAKAPAKAAAKPAA
KPAAAKPAAAKPTAAKPAVAKPAAAKPAAKPAAKPAVKKPAAAKPATAPAAKPATPAPTT
APAPTASTPAAATSPSAAVAPSISSTPTSAS