Protein Info for Pf6N2E2_4430 in Pseudomonas fluorescens FW300-N2E2

Annotation: Autolysis response regulater LytR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00072: Response_reg" amino acids 3 to 114 (112 residues), 96.2 bits, see alignment E=1.4e-31 PF04397: LytTR" amino acids 149 to 245 (97 residues), 73.4 bits, see alignment E=1.4e-24

Best Hits

Swiss-Prot: 83% identical to ALGR_PSEAE: Positive alginate biosynthesis regulatory protein (algR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K08083, two-component system, LytT family, response regulator AlgR (inferred from 100% identity to pba:PSEBR_a5477)

Predicted SEED Role

"Autolysis response regulater LytR" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZW8 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Pf6N2E2_4430 Autolysis response regulater LytR (Pseudomonas fluorescens FW300-N2E2)
MNVLIVDDEPLARERLSRMVGELEGYSVLEPSATNGEEALALIDSHKPDIVLLDIRMPGL
DGLQVAAKLCERESPPAVVFCTTRDDFPPEVLQAGAVGYLVKPVATEALLEALRKAERPN
RVQLAALTRPAAESGSGPRSHISARTRKGIELIPLNQVVYFIADHKYVTLRHESGEVLLD
EPLKALEDEFGERFVRIHRNALVARERIERLQRTPLGHFQLFLKGLNGDALIVSRRHVAG
VRKMMQQL